Product
|
LL-37
- Brand：NO
- Model：1G,10G,1KG,5KG,25KG
- Purity：98%
- Cas：597562-32-8
- Createtime： 2026-07-02
- Updatetime： 2026-07-16
Product Details
| useage | FOR R&D RESEARCH USE |
| deliveryInfo | |
| appearance | white to off white powder |
| aliasen | |
| supplyCapacity | 500000KG/Year |
| harbor | SHENZHEN |
| minorder | 1G |
LL-37 Amide (Human Cathelicidin Antimicrobial Peptide) CAS 597562-32-8 Full English Technical Datasheet
1. Basic Chemical Information
- CAS No.: 597562-32-8
- Full Name: Antibacterial Protein LL-37 amide (human)
- Short Name: LL-37, Cathelicidin LL-37, CAMP peptide
-
Full Amino Acid Sequence:
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH?
- Single Letter Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH?
- Molecular Formula: C???H???N??O??
- Molecular Weight: 4492.28 g/mol
- MDL No.: MFCD08460571
- Core Feature: Endogenous human cathelicidin host defense peptide, broad-spectrum antibacterial, anti-inflammatory, skin barrier repair active peptide
2. Physical & Chemical Properties
| Test Item | Standard Specification |
|---|---|
| Appearance | White lyophilized fine crystalline powder |
| Odor | Odorless |
| Solubility | Fully soluble in purified water, PBS buffer; soluble in ethanol; insoluble in DMSO, mineral oil, acetone |
| pH (0.1% aqueous solution) | 5.0 ~ 7.2 |
| Thermal Stability | Add below 40℃ during emulsification; sustained heating above 55℃ breaks peptide secondary structure and loses activity |
| Stability | Stable under weak acid & neutral cosmetic systems; incompatible with strong alkali, high-concentration oxidants, long-term UV exposure; prone to oxidation by air |
| Hygroscopicity | Moderately hygroscopic, nitrogen-filled vacuum sealed storage required |
3. Quality Specifications (Cosmetic / Cell Research Grade)
| QC Item | Standard Limit | Test Method |
|---|---|---|
| Assay (HPLC, anhydrous basis) | ≥98.0%; Premium ≥99.0% | RP-HPLC UV 220 nm |
| Loss on Drying (KF) | ≤0.50% | Karl Fischer Titration |
| Residue on Ignition | ≤0.10% | Gravimetry |
| Single Unknown Related Impurity | ≤0.30% | HPLC |
| Total Related Impurities | ≤1.50% | HPLC |
| Endotoxin | ＜50 EU/mg | LAL Test |
Heavy Metals
Lead (Pb) ≤0.5 ppm; Arsenic (As) ≤1.0 ppm; Cadmium (Cd) ≤0.1 ppm; Mercury (Hg) ≤0.1 ppm
Microbial Limits
Total Aerobic Microbial Count ≤500 CFU/g; Yeast & Mold ≤50 CFU/g; E. coli, Salmonella, S. aureus Negative per 25g
4. Core Biological Mechanism & Efficacy
-
Broad-Spectrum Antibacterial & Antifungal (Core Function)
Amphipathic α-helical structure inserts into microbial membrane, destroys bacterial membrane integrity; effective against Gram-positive / Gram-negative bacteria, fungi, Malassezia (scalp dandruff pathogen), acne Propionibacterium acnes.
-
Powerful Anti-Inflammaging & Calming Sensitive Skin
Inhibits TLR2/TLR4 inflammatory signal pathway, reduces UV-induced TNF-α, IL-6 release, relieves facial redness, acne inflammation, post-procedure skin irritation and sensitive skin itching.
-
Repair Skin Barrier & Promote Epidermal Renewal
Stimulates keratinocyte migration and proliferation, upregulates filaggrin and involucrin synthesis, tightens epidermal arrangement, reduces transepidermal water loss, improves dry fragile barrier.
-
Antioxidation & Anti-Photoaging
Scavenges intracellular ROS free radicals, alleviates UV DNA damage, prevents dullness, rough texture and premature skin aging.
-
Anti-Dandruff & Anti-Inflammatory Scalp Care
Inhibits Malassezia reproduction, relieves scalp itching, flaking and inflammatory hair loss; synergistic with biotinoyl tripeptide-1 for anti-shedding formulas.
5. Application Fields & Recommended Dosage
5.1 Acne & Sensitive Repair Skincare
Anti-acne serum, redness-soothing lotion, post-sun repair gel, sensitive barrier repair cream
- Recommended addition: 0.0001% ~ 0.05% (w/w)
5.2 Scalp Anti-Dandruff & Anti-Hair Loss Care
Anti-dandruff shampoo, anti-scalp-itch essence, anti-inflammatory hair tonic
- Recommended addition: 0.0001% ~ 0.03% (w/w)
5.3 Post-Procedure Medical Skincare
Micro-needle recovery soothing mask, after-sun calming nourishing cream
- Recommended addition: 0.0001% ~ 0.03% (w/w)
Formula Operation Tips
Optimal pH range: 4.5–7.0; compatible with panthenol, hyaluronic acid, copper peptide, salicylic acid low concentration; avoid strong oxidants and high-temperature long-time heating.
6. Safety Profile
- Low irritation risk to facial skin, scalp and ocular mucosa at cosmetic routine dosage
- Non-sensitizing, non-phototoxic, rare contact allergy cases
- Endogenous human host defense peptide, excellent biocompatibility with keratinocytes and vascular endothelial cells
- No cytotoxicity recorded under standard leave-on cosmetic concentration
7. Storage & Packaging
- Storage Condition: Hermetic nitrogen-filled aluminum foil vacuum bag; long-term storage at -20°C, strictly light-proof, oxygen-proof & moisture-proof; avoid repeated opening and freeze-thaw cycles; short-term storage ≤4°C
- Shelf Life: 36 months under intact original vacuum packaging
- Packaging: 100mg/1g/5kg nitrogen-filled aluminum vacuum foil bags for cosmetic factories; bulk 25kg double PE inner bag + paper drum
